PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023905m
Common NameCARUB_v10023905mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 254aa    MW: 29464.8 Da    PI: 5.7967
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023905mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.28.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv++++++G  +W++ +++ g+ R++k+c++rw +yl
  Carubv10023905m 14 RGPWTPEEDQILVNYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding52.98.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  Carubv10023905m  67 RGNFTPQEEETIINLHESLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.619961IPR017930Myb domain
SuperFamilySSF466898.07E-3110108IPR009057Homeodomain-like
SMARTSM007173.0E-151363IPR001005SANT/Myb domain
PfamPF002493.0E-171461IPR001005SANT/Myb domain
CDDcd001671.87E-111661No hitNo description
PROSITE profilePS512942562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2765117IPR009057Homeodomain-like
SMARTSM007172.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.05E-969112No hitNo description
PROSITE patternPS000180170182IPR018247EF-Hand 1, calcium-binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRAPCCEKM GMKRGPWTPE EDQILVNYIH LYGHSNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPQEEETIIN LHESLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLNKNQ  120
NNGGDTKENI NGINETTTHE DKESSMVHVV DTTSPQQFSN SITTFDISND INKDGIMSYE  180
DISALIDESF WSDVVTVDNS NHKIEDWEGT LMDRNIKRKS YNNSELYNDD MEFWFEHFTS  240
NRRIEEFSDI PEC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195750.0AY519575.1 Arabidopsis thaliana MYB transcription factor (At2g31180) mRNA, complete cds.
GenBankBT0248530.0BT024853.1 Arabidopsis thaliana At2g31180 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294854.10.0hypothetical protein CARUB_v10023905mg
TrEMBLR0FXK40.0R0FXK4_9BRAS; Uncharacterized protein
STRINGAT2G31180.11e-154(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-157myb domain protein 14